PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G23660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 903aa    MW: 95695.6 Da    PI: 6.9702
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G23660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-21127183157
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                   +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k+
  OB09G23660.1 127 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMKQ 183
                   688999************************************************996 PP

2START169.42.4e-533485811205
                   HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
         START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                   ela++a++elvk a+ +ep+W  s     e +n+de+ + f++  +     + +ea r+sg+ +  +++lv +l+d + +W+e+++    +a+t++ 
  OB09G23660.1 348 ELALAAMDELVKVAQMDEPLWLPSLdggfEALNYDEYHRAFARVLGqspgsYVSEATRESGIAIISSVDLVDSLMDAP-RWSEMFPcivaRASTTDI 443
                   5899*************************************8865599******************************.****************** PP

                   ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--...........-TTSEE-EESSEEEEEEEECTCEEEE CS
         START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..........sssvvRaellpSgiliepksnghskv 164
                   issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p +          sss++ ++llp+g++++++ ng+skv
  OB09G23660.1 444 ISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVLRPDQnggggggvssSSSYMGCRLLPTGCIVQDMNNGYSKV 540
                   ******************************************************988776556667777789************************* PP

                   EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
         START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                   twv h+ +++  +h+l+r+l++sg+a ga++w+a lqrqc+
  OB09G23660.1 541 TWVVHAAYDETAVHQLYRPLLRSGQAPGARRWLASLQRQCQ 581
                   ****************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.19E-23109185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-23115184IPR009057Homeodomain-like
PROSITE profilePS5007118.317124184IPR001356Homeobox domain
SMARTSM003895.0E-19125188IPR001356Homeobox domain
PfamPF000466.5E-19127183IPR001356Homeobox domain
CDDcd000861.01E-19127185No hitNo description
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PROSITE profilePS5084840.604339585IPR002913START domain
SuperFamilySSF559618.52E-29343581No hitNo description
PfamPF018528.7E-45348581IPR002913START domain
SMARTSM002343.0E-37348582IPR002913START domain
CDDcd088751.17E-97354581No hitNo description
SuperFamilySSF559619.48E-13601792No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 903 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAG GGGGGGGGGG VHNSRLLPAP PVPKPGGGYA APGLSLGLQT  60
NMDGGHLGDM NRSLAMMGNG GSGSGGDGDS LGRGREDEND SRSGSDNLDG ASGDDLDPDN  120
SNPRKKKKRY HRHTPQQIQE LEAVFKECPH PDEKQRMELS RRLNLESRQV KFWFQNRRTQ  180
MKQTQIERHE NALLRQENDK LRAENMTIRE AMRNPMCASC GGAAVLGEVS LEEQHLRIEN  240
ARLKDELARV CALAGKFLGR PISSISSPSP PSLQACSGLE LGVGSNGFGL GALGASGLQS  300
IPDLMGGSAG LPVGSAAMRL PAGIGGLDGA MHAAAADGGA IDRAVLLELA LAAMDELVKV  360
AQMDEPLWLP SLDGGFEALN YDEYHRAFAR VLGQSPGSYV SEATRESGIA IISSVDLVDS  420
LMDAPRWSEM FPCIVARAST TDIISSGMGG TRSGSIQLMH AELQVLSPLV PIREVVFLRF  480
CKQHAEGLWA VVDVSVDAVL RPDQNGGGGG GVSSSSSYMG CRLLPTGCIV QDMNNGYSKV  540
TWVVHAAYDE TAVHQLYRPL LRSGQAPGAR RWLASLQRQC QYLAILCSNS LPARDHAAIT  600
PVGRRSMLKL AQRMTDNFCA GVCASAAQKW RRLDEWRGGE GGGGAGDGED KVRMMARHSV  660
GAPGEPPGVV LSATTSVRLP GTLPQRVFDY LRDEQRRGDW DILANGEAMQ EMDHIAKGQH  720
HGNAVSLLRP NATSGNQNNM LILQETCTDS SGSLVVYAPV DVQSMHVVMN GGDSAYVSLL  780
PSGFAILPDG HNSASPSPVD VGSASPSSTA GAGATGGGRQ QQHRLAGDGG VPDPRQQSAH  840
REAHRRVGRH RQQPPLLHHP EDQVRSAGQH HLAIDSGHLT WIPSRPVTKG SIRMPPQMSN  900
LRG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123128RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8102820.0DQ810282.1 Oryza brachyantha BAC 0002C07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696802.10.0PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein ROC6-like
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLJ3MZD70.0J3MZD7_ORYBR; Uncharacterized protein
STRINGOB09G23660.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-173HD-ZIP family protein